DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and nhr-246

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:326 Identity:76/326 - (23%)
Similarity:125/326 - (38%) Gaps:58/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GVSFARWADGGESPVTEQLSLIVKTIPITEATQFLEDV-CVFIKEKQTYTD---VLPRLDILSRG 119
            |.|....|.||           ||.:..:...:|:.:. |.:.|...:.::   .:|...:.|:.
 Worm    73 GCSVVENAGGG-----------VKNVDHSVVERFMHNTECNYYKLFSSLSEKPLQIPTTYLASKA 126

  Fly   120 DTFGAKYYHSVKTPVQTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAK-KD- 182
                     ..|.||..||...|  |..|:.....|.:.:....|:.:|.|.|..|:...| |: 
 Worm   127 ---------GEKAPVPVIVLEML--EDCKLHDLIPGFNEDQLFKIVDELVKLHIFSLTTEKWKEI 180

  Fly   183 -PAIVKQYTRGMLSEDILMKSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNVCAD 246
             |...|....|.|.   .|.:|...::......|:|.|... ...:....:||::.|.:.|    
 Worm   181 VPDESKLAMSGFLQ---CMVADVGRKLAQNPELGVILSYVE-NTLDTDPNYLQKMRDEYIN---- 237

  Fly   247 APRPRKGDRYVVLNHGDLWTNNFMYG-YDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSI 310
                  .:|..|:.|||||....::. .||.        |..||:|.:..|||..||:..|:|..
 Worm   238 ------EERPSVICHGDLWAPQILWDKEDNI--------AGIVDWQATHRGSPMEDLHHILSTCT 288

  Fly   311 KLQLLQERREELIKVYYASFKDALEYARFEDIPSYEDLQYELRSRETYG----LF--GMFAFLPM 369
            .:|..:...:.|:..||...|..|:...|:...:.|::..|......||    :|  |.:|..|:
 Worm   289 SVQNRKTFTKPLLDHYYNKLKVGLKEKGFKTTWTREEIDIEYNYSFIYGASRTIFANGFWANSPV 353

  Fly   370 I 370
            :
 Worm   354 L 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 67/287 (23%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 52/203 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.