DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and Y11D7A.8

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_501614.2 Gene:Y11D7A.8 / 189433 WormBaseID:WBGene00012432 Length:433 Species:Caenorhabditis elegans


Alignment Length:371 Identity:72/371 - (19%)
Similarity:129/371 - (34%) Gaps:101/371 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DNYCSAIYRVGVSFARWADGGESPVTEQLSLIVKTIPITEATQFLED----VCVFIKEKQTY--T 107
            |...|::.|  |:|. | |..|.|    .|:::|| |:.:..:..|:    ..:|.:|...|  |
 Worm   112 DYATSSVVR--VTFG-W-DDDELP----RSVVLKT-PVAKDQRDDEEGKYHYIMFKRECNVYEWT 167

  Fly   108 DVLPRLDILSRGDTFGAKYYHSVKTPVQ---TIVFSDLTVEGFKVASREKGLDWNHASLILQQLG 169
            ...|:|        ...|..|..|...:   .:|..|::.:| :.....|||.......:|:|:.
 Worm   168 QKFPKL--------IAPKIIHIKKHSKEGSGVVVMEDVSEKG-QEQDPVKGLMLEVVRDLLKQIA 223

  Fly   170 KFHATSM------VLAKKDPAIVKQYTRGMLSEDILMKSDTFEQMFGGFLKGLIKSSASWAGYEK 228
            ..|:.|:      .|....|.....:|.|...:.:     ||.:          :.....:.:..
 Worm   224 YLHSISLKHTSWSTLVADLPPSYYAHTIGSFDDTL-----TFFE----------RQDVDHSRFVH 273

  Fly   229 ISKHLQRLMDNFRNVCA-------DAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAI 286
            |.|:..   |.:.:..|       |.|:        ||.||:.:.:|.....:...|     |.:
 Worm   274 IGKYFS---DEYLHSTATETTELLDIPK--------VLVHGEPYASNVFTKMEGKEQ-----RIL 322

  Fly   287 -FVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVYYASFKDALEYARF--EDIPSYEDL 348
             .:|:.....|..|.|:...:..::..:...:....|::.|:      ...||:  .|.|...|:
 Worm   323 SLIDWTEGHSGCFAEDVAKIICWNLNAKERVDNTSSLLEGYH------FHLARYYDGDCPFTVDI 381

  Fly   349 QYELRSRETYGLFGMFAFL----------------PMITMPKELAQ 378
                 .:..|.:|..||.:                |:|...|.|.|
 Worm   382 -----IQRAYEVFVPFAMVSLCGKVMSVKNKTEKEPLIERAKSLIQ 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 59/312 (19%)
Y11D7A.8NP_501614.2 CHK 192..373 CDD:214734 37/218 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.