DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and T16G1.3

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:273 Identity:72/273 - (26%)
Similarity:123/273 - (45%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ILQQLGKFHATSMVLAKKDPAIVKQY-----TRGMLSEDILMKSDTFEQMFGGFLKGLIKSSASW 223
            ||:.|..|.|.|:.|.|::...|..|     ...|.|::.|  :..|||     ::.:.|...|.
 Worm   148 ILKSLAVFQAESLKLNKREQESVTGYDLEKIVGKMFSQNGL--NSIFEQ-----VRQINKEELSE 205

  Fly   224 A-------GYEKISKHLQRLMDNFRNVCADAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDV 281
            |       |.|.::..|.:.::|:..:       :|.    ||.|||||:.|.|: .:|..:..|
 Worm   206 AADKIAVFGVELVNFDLVKNLNNYLGI-------KKN----VLVHGDLWSANIMW-KENKDEFRV 258

  Fly   282 PTRAIFVDFQLSFYGSPACDL-NFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSY 345
            ..   .:|:|....|:||.|| ..|::| :.....|:..|:|::.:|..|.:|||   .:::|  
 Worm   259 DK---IIDYQSIHLGNPAEDLVRLFIST-LSGSERQKYWEKLLEQFYEYFIEALE---DKNVP-- 314

  Fly   346 EDLQYELRS-RETYGLFGMFAFLPMITMPKELAQDNSIE-NMQDEAFKQRKMDAIFSQKFLNDHQ 408
                |.|.. :|:|.|:.:...|.|:.|...:|:....| :..||..|.|::....:::.|||.:
 Worm   315 ----YTLEQLKESYRLYFVTGSLLMLPMFGPIAEVKLAEMSDPDEVKKYREILTEKTKRLLNDME 375

  Fly   409 -----------KW 410
                       ||
 Worm   376 HRHLYTREIIKKW 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 52/187 (28%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 70/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.