DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and E02C12.12

DIOPT Version :10

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:140 Identity:26/140 - (18%)
Similarity:47/140 - (33%) Gaps:55/140 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 DNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVYYASFKDALEY-A 337
            :..:.||:|...:   :.|..| |.|.||..|:                          .:|: .
 Worm   102 EKMNHPDIPYTKV---YGLKGY-SDANDLKGFM--------------------------IMEFIP 136

  Fly   338 RFEDIPSYE-----DLQYELRSRETYGLFGMFAFLPMITMPKELAQDNS--------IENMQDEA 389
            ....||.||     ||...:|...|:...|           :.|:::..        :|:|.:|.
 Worm   137 NVRSIPMYEAILADDLISLVRGIATFAALG-----------ETLSEEEKAFAGGPEYLESMFEEV 190

  Fly   390 FKQRKMDAIF 399
            |...:::.|:
 Worm   191 FTDEQLERIY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKL 47..339 CDD:397213 11/65 (17%)
E02C12.12NP_505432.2 Protein Kinases, catalytic domain 1..>200 CDD:473864 25/138 (18%)

Return to query results.
Submit another query.