DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and C29F7.1

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:291 Identity:66/291 - (22%)
Similarity:121/291 - (41%) Gaps:53/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CVFIKEKQTYTDVLPRLDIL----SRGDTFGAKYYHSVKTPVQTIV---FSDLTVEGFKVASREK 154
            |.:....:.|||:..::.::    ..||         .:.||..||   |.|.||...     ..
 Worm   108 CNYYNVFRKYTDLPMKVPVIYCAAKAGD---------AEAPVPVIVMEMFEDCTVHDL-----ID 158

  Fly   155 GLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGMLSEDILMKS-DTFEQMFGGFLKGLIK 218
            |.|.:....|:.::...|..|         :..:..|.:|.:..:..: |.||.|    :|.:.:
 Worm   159 GFDKDQLFKIVDEIVNLHIFS---------LTTEEWRSVLPDSAMRDTVDLFEAM----VKTIAE 210

  Fly   219 SSASWAGYEKISKHLQRLMD---NFRNVCADAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPD 280
            :.|...|.|.|||::::..|   :|....:|  ...:|.|..||.|||||:...::..|:     
 Worm   211 NMAKSPGLEIISKYIEKTFDKDPSFMTKFSD--EYLEGKRKSVLTHGDLWSPQILWDKDD----- 268

  Fly   281 VPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSY 345
              ..|..:|:|:...|||..||:..|:|...::...:..:.|:..|:......||....:...:.
 Worm   269 --NIAGIIDWQVGHQGSPMEDLHRILSTGTSVENRNKLTKPLLDHYFEKLSAGLEEKGVKMPWTR 331

  Fly   346 EDLQYELRSRETYG----LF--GMFAFLPMI 370
            |::..|.....:||    :|  |:::..|::
 Worm   332 EEVDEEYNHCFSYGASITIFSNGIWSSSPIL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 59/252 (23%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 50/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.