DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and T16G1.5

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_506235.1 Gene:T16G1.5 / 179775 WormBaseID:WBGene00011799 Length:434 Species:Caenorhabditis elegans


Alignment Length:276 Identity:69/276 - (25%)
Similarity:119/276 - (43%) Gaps:63/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ILQQLGKFHATSMVLAKKDPAIVKQYT-RGMLSEDILMKSDTFEQMFGGFLKGLIKSSASWAGYE 227
            |||.|....|.|:.|.:.:...:..|. :.|:..  :|..:..:||:         :.|.....|
 Worm   186 ILQSLATLQAGSLHLTEDEINSISGYDFKSMVGR--MMSEEGMKQMY---------TRARQINPE 239

  Fly   228 KISKHLQRL----MD--NFRNVCADAPRPRKGDRYV-----VLNHGDLWTNNFMYGYDNASQPDV 281
            :::|....:    ||  ||...|       ..::|.     ||.|||||..|.::..::.:  .|
 Worm   240 RLTKPTDAVEALGMDIVNFEISC-------HVNKYAGIQKNVLVHGDLWAANILWKENDGN--CV 295

  Fly   282 PTRAIFVDFQLSFYGSPACDL-NFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSY 345
            .::.|  |:||...|:||.|| ..||:| :.....|...|:|::.:|..|.:|||         .
 Worm   296 ASKVI--DYQLIHMGNPAEDLVRVFLST-LSGADRQAHWEKLLEQFYEYFLEALE---------G 348

  Fly   346 EDLQYEL-RSRETY-------GLFGMFAFLPMITMPKELAQDNSIENMQD--EAFKQRKMDAIFS 400
            .:..|.| :.:|:|       |||.|..|.|:.......:.||  ||:::  |...::      :
 Worm   349 NEAPYTLDQLKESYRLYFVGGGLFVMPLFGPVAQAKLSYSTDN--ENVEEYREVLTEK------A 405

  Fly   401 QKFLNDHQKWALKRAD 416
            ::.:.|.::|.|...|
 Worm   406 ERLMEDLKRWHLYSKD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 50/187 (27%)
T16G1.5NP_506235.1 DUF1679 8..420 CDD:369592 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.