DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and pkdc

DIOPT Version :9

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:215 Identity:49/215 - (22%)
Similarity:77/215 - (35%) Gaps:73/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ENSLVFEDLAEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIFDAYGDGMLSPRG 195
            |..:|.|||...||.:  |:..:|:...:..:..:|.|||..:.                ::|.|
Zfish   107 EQLIVLEDLDVAGFPV--RKTYVNDAEIKACLSWIANFHALFLD----------------VTPEG 153

  Fly   196 LAKDDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQRANLERSQAPQEKEVK------ 254
            |                        ||        ||.|. :.....|..:|..::::|      
Zfish   154 L------------------------WP--------IGTYW-HLETRPEELEAMSDQKLKAAAGEI 185

  Fly   255 --VLN--------HGDLWVNNMLFKYDGAQRPQDLILIDFQLSVWGSPGI-DLNYFFYTSLTLEV 308
              :||        |||..:.|..|..||.|    :..:|||. |.|..|: |:.||..:.:....
Zfish   186 DSILNNCRFKTIVHGDAKLANFCFSKDGLQ----VASVDFQY-VGGGCGMKDVIYFLGSCMDERE 245

  Fly   309 LRHRRTQLLRTYHARLAKTL 328
            ...:...||..|.:.|.|:|
Zfish   246 CEKKAPGLLDYYFSELRKSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 49/215 (23%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 49/215 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.