DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and CG31370

DIOPT Version :9

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:422 Identity:101/422 - (23%)
Similarity:164/422 - (38%) Gaps:46/422 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ADVVAPPSHLDVPFFEEVLETALRTARVQLLSIHIRMGSSTGENYCSQIYRVKVSFKRPDHPEQH 72
            ||.:..|..|:..|..:||.:..:...:::..:....||:.|:||.|.|.|.:|.:      ...
  Fly     7 ADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEY------ITQ 65

  Fly    73 MAFIVKSIPHLDSVEFIDDLQVYLKEKITYYEVLPRLELLMQCNR---RFGPKLYHYLKQPENSL 134
            ..|..||:.....:|......::..|...|.:|||....:::.|.   |...:..:|..:|...:
  Fly    66 KGFFSKSLIIKTVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQVM 130

  Fly   135 VFEDLAEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIFDAYGDG--------ML 191
            :||||.|..:.|....:..:.|.|. ...:||:|||.||.:....|.....:.||        |.
  Fly   131 IFEDLGEMDYAMVRDRVLTHGEICG-AYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPYMS 194

  Fly   192 SPRGLAKDDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQRANLERSQAPQEKEVKVL 256
            |..|..||       |.|...||....:   .||||..   .::...|..::..|...:....||
  Fly   195 SGMGPFKD-------FLGRIPELDRYKT---HFEKIEV---HFIDRLRDIMKEYQTNPQPGYYVL 246

  Fly   257 NHGDLWVNNMLFKYDGAQRP-QDLILIDFQLSVWGSPGIDLNYFFYTSLTLEVLRHRRTQLLRTY 320
            .|||....|::.|::..... :|.:|:|:|.........||.|..|..:..|........||..|
  Fly   247 CHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYY 311

  Fly   321 HARLAKTLLDLDMGIPVPSYEQILEEVHRRESYGFFASYGIFPTVSQDKAQTADNNLENFKDADF 385
            .:.|.:||..:.....:|......:|::|.:.|.|.......|.......:||.|...:.|..||
  Fly   312 FSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEETDDKLQDF 376

  Fly   386 AKQKVRQMFQSRRLADTLRYTLPHFERAGVLD 417
            .::              .:..|..|||:|..:
  Fly   377 IEE--------------CKSILARFERSGYFE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 75/293 (26%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 75/296 (25%)
APH <202..320 CDD:279908 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459316
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.