DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and JhI-26

DIOPT Version :9

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:315 Identity:79/315 - (25%)
Similarity:136/315 - (43%) Gaps:47/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VLETALRTARV-------QLLSIHIR------MGSSTG--ENYCSQIYRVKVSFKRPDHPEQHMA 74
            ||.:.||..|:       ::.:.|:.      :|.|..  ..:|   ||..::|:. |..:....
  Fly    15 VLPSILRNGRLVDNYSESKVTTFHVGDIDIDVIGHSEAFMLTFC---YRTTINFEY-DGQKFQRK 75

  Fly    75 FIVKSIPHLDSVEFIDDLQ---VYLKEKITYYEVLPRLELLMQCNRRFGPKLYHY--LKQPENSL 134
            .:||..|.:.. |..:.:|   ::..|...|.|:||..:..  .:.:|....|:|  |.|.....
  Fly    76 MVVKKTPAMPP-EMYESIQFGPLFTNEINFYTEILPEFQKF--TDGKFAAPKYYYGELNQHSAVA 137

  Fly   135 VFEDLAEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIFDAYGDGMLSPRGLAKD 199
            :.|:.||:|:.:....:||:.:|..:.:..|..||..:.|:...:|..|....|.:...| .|.|
  Fly   138 ILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLTDNLKESR-YAND 201

  Fly   200 D-----GLLMQFFSGNGKELHHLVSTW-PGFE-----KIAEKIGKYMQNQRANLERSQAPQEKEV 253
            :     .|.|:.......:   .|:|: |..:     |....|..|.|..|..:    ||:| .:
  Fly   202 NIHPEWKLTMKTSIDRAAK---AVATYQPQIDEEFVKKFCFMISDYSQYGRQRV----APRE-PL 258

  Fly   254 KVLNHGDLWVNNMLFKYDGAQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLTLEV 308
            ..|.|||...||:.::||..:.||::::.|:|.....||.:|||.|...|:..||
  Fly   259 ATLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 71/278 (26%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 71/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.