DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and CG31099

DIOPT Version :9

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:415 Identity:96/415 - (23%)
Similarity:191/415 - (46%) Gaps:58/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VLETALRTARVQLLSIHIRMGSSTGENYCSQIYRVKVSFKRPDHPEQHMAFIVKSIPHLDSVE-- 87
            |||..::...| :.|:|:....:     |:.:..::|..:..|...:.:.|::|: .|...::  
  Fly    22 VLEDGVQITSV-IPSVHLIQFRN-----CTVLLPIQVKVQLRDFTMKKLFFLLKA-QHGTDIQAM 79

  Fly    88 FIDDLQVYLKEKITYYEVLPRL-ELLMQCNRR--FGPKLY--------HYLKQPENSLVFEDLAE 141
            .::.|:::.:|...|:.|||:| |:..:..::  |||:.:        .|       ::.|||..
  Fly    80 VMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQY-------VLLEDLKA 137

  Fly   142 KGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIFDAYGDGMLSPRGLAKDDGLLMQF 206
            |.:....|:.|.|:...:.|:::||:|||.|  ...|:.|  .|:.:.:::......::.:|.:.
  Fly   138 KSYKNVERQAGFNKLCLKQVLKKLAQFHAAS--AVCVEKH--GAFSNLLVNGVYTKANESVLQEL 198

  Fly   207 FSGNGKELH-HLVSTWPGFEKIAEKIGKYMQNQRANLERS--------QAPQEKEVKVLNHGDLW 262
               |..|:. ..:..|        ::|.:...:....|:.        .:|...|..||||.|.|
  Fly   199 ---NDPEIFLSQLRRW--------RLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCW 252

  Fly   263 VNNMLFKYDGAQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLTLEVLRHRRTQLLRTYHARLAKT 327
            |||::||:|.:...:|..|:|:||..:|||.|||.|...:|...::...:...:::.|...|...
  Fly   253 VNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDN 317

  Fly   328 LLDLDMGIPVPSYEQILEEVHRRESYGFFASYGIFPTVSQDKAQTADNNLENFKDADFAKQKVRQ 392
            |..|:.|..:|..:.|.:.:::..    .|:|.:   |::....|..|..|:..:..:|.:....
  Fly   318 LKALNFGGSLPQLQHIRDALNKNG----LAAYVV---VTRALPITMMNQFEDEVNERYASKMKCA 375

  Fly   393 MFQSRRLADTLRYTLPHFERAGVLD 417
            ||.||:....::..||..|...:|:
  Fly   376 MFTSRKYIQAIKDILPWMEERSLLN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 71/303 (23%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 72/301 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459268
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.