DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and E02C12.6

DIOPT Version :9

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_505426.2 Gene:E02C12.6 / 183987 WormBaseID:WBGene00017092 Length:419 Species:Caenorhabditis elegans


Alignment Length:337 Identity:76/337 - (22%)
Similarity:132/337 - (39%) Gaps:97/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QIYRVKVSFKRPDHPEQHMAFIVKSIPHLDSVEFIDDLQVYLKEKITYYEVLPRLELLMQCNRRF 119
            :.|:|...|..||.|       ...:..|......|||:.||   ||  :.:|.:.::..     
 Worm   119 ETYKVLTKFNHPDIP-------YTKVYSLKPFNGEDDLKGYL---IT--DFIPNVHVIEA----- 166

  Fly   120 GPKLYHYLKQPENSL--------VFEDLAEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALA 176
                  |...|.:::        .|..|||                 .|..|....|.:|.....
 Worm   167 ------YKSIPADNIAATIRGIATFSALAE-----------------HLEREEQKSFMSTDFLEL 208

  Fly   177 VVDPHIFDAYGDGMLSPRGLAKDDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQ---NQ 238
            :.:    |.:.|..||                   |:...|.:.:.| ::.|||:.|.::   :.
 Worm   209 LFE----DFFTDAELS-------------------KKFEALKTKFEG-QQHAEKVSKLIKVFAHY 249

  Fly   239 RANLER----SQAPQEKEVKVLNHGDLWVNNMLFKYDGAQRPQDLILIDFQLSVWGSPGIDLNYF 299
            :|.:::    |.....|.|.:  |||||.:|::|..|.:::.:...:||:|......|||||:..
 Worm   250 KALVKKYTNISDLLGLKPVFI--HGDLWQSNIMFTLDNSKKLKLEAIIDWQSVSRIPPGIDLSRI 312

  Fly   300 FYTSLTLEVLRHRRTQLLRTYHARLAKTLLDLDMGIPVPSYEQILEEVHRRESYGFFA---SYGI 361
            ....|:.:..|.|.|:||:.||...||.     .|..:.:::::      ::||..:|   :..|
 Worm   313 MLGCLSAQERRERGTELLKLYHETYAKV-----FGKELFTFQEL------QDSYNLYAPMMAMLI 366

  Fly   362 FPTVSQ--DKAQ 371
            .|::|.  |.||
 Worm   367 LPSLSSFLDSAQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 66/290 (23%)
E02C12.6NP_505426.2 DUF1679 3..410 CDD:369592 76/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto18687
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.