DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and C29F7.1

DIOPT Version :9

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:193 Identity:54/193 - (27%)
Similarity:86/193 - (44%) Gaps:20/193 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VVDPHIFDAYGDGMLS--PRGLAKDDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQR 239
            :|:.|||....:...|  |....:|   .:..|....|.:...::..||.|.|::.|.|......
 Worm   172 IVNLHIFSLTTEEWRSVLPDSAMRD---TVDLFEAMVKTIAENMAKSPGLEIISKYIEKTFDKDP 233

  Fly   240 ANLER--SQAPQEKEVKVLNHGDLWVNNMLFKYDGAQRPQDLI--LIDFQLSVWGSPGIDLNYFF 300
            :.:.:  .:..:.|...||.|||||...:|:..|      |.|  :||:|:...|||..||:...
 Worm   234 SFMTKFSDEYLEGKRKSVLTHGDLWSPQILWDKD------DNIAGIIDWQVGHQGSPMEDLHRIL 292

  Fly   301 YTSLTLEVLRHRRTQLLRTYHARLAKTLLDLDMGIPVP-SYEQILEEVHRRESYGFFASYGIF 362
            .|..::|........||..|..:|:..|  .:.|:.:| :.|::.||.:...|||  ||..||
 Worm   293 STGTSVENRNKLTKPLLDHYFEKLSAGL--EEKGVKMPWTREEVDEEYNHCFSYG--ASITIF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 42/159 (26%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 42/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.