DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9497 and dhs-27

DIOPT Version :9

Sequence 1:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_508591.3 Gene:dhs-27 / 180632 WormBaseID:WBGene00000990 Length:320 Species:Caenorhabditis elegans


Alignment Length:256 Identity:53/256 - (20%)
Similarity:86/256 - (33%) Gaps:89/256 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LGLNEEHCQLVMERLAEFHATSMALAVVDPHIFDAYGDGMLS-PRGL-AKDDGLLMQFFSGNGKE 213
            :|.|.:......:.|.|.|...:..     |:.|...|.:.: |:.| ..|.|:|:. .:|... 
 Worm    80 IGRNIDKLNNTKKELVEQHGCEVMC-----HVHDFEKDDLSALPKDLETLDVGILIN-CAGIAP- 137

  Fly   214 LHHLVSTWPGF-EKIAEKIGKYMQNQRANLERSQAPQEKEVKVLNHGDLWVNNMLFKYDGAQRPQ 277
              |::.|.... |.:|.||      .|.||          :..:...::.:.||:.|..|     
 Worm   138 --HIIGTLTELPEGLASKI------LRVNL----------MSAVKMTEMILPNMVKKKRG----- 179

  Fly   278 DLILIDFQLSVWGSPGIDLNY------------FFYTSLTLEVLRHRRTQLLRTYHARLAKTLLD 330
              |:::........|   |.|            ||..||:.|   :|.|.:       ..:.|:.
 Worm   180 --IIVNISSMTGWRP---LPYLSSYPASKAALSFFSDSLSDE---YRGTGI-------RVQCLIP 229

  Fly   331 LDMGIPVPSYEQILEEVHRRESYGFFASYGIFPTVSQDKAQTADNNLENFKDADFAKQKVR 391
            :.:...|.|||                            |:.| ||:......:||||.||
 Worm   230 MLVATKVASYE----------------------------AEEA-NNIFVVTPENFAKQAVR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 39/194 (20%)
dhs-27NP_508591.3 17beta-HSD1_like_SDR_c 48..294 CDD:187614 53/256 (21%)
adh_short 50..234 CDD:278532 39/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.