DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr and AT3G24710

DIOPT Version :10

Sequence 1:NP_477158.1 Gene:Cpr / 33883 FlyBaseID:FBgn0015623 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_189114.2 Gene:AT3G24710 / 822068 AraportID:AT3G24710 Length:66 Species:Arabidopsis thaliana


Alignment Length:63 Identity:17/63 - (26%)
Similarity:35/63 - (55%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 IWNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADAVQYIKKMEAQKRYSADVWS 679
            :|:::.:. ...|:.|.:..|..||.:.|.:|:|.:...|:..|.:.:|.:|..:||:.:.||
plant     5 VWDLLCDG-AVVYVAGSSTEMPSDVMSALGEIVSEETGGSKEVASRRLKALEKAQRYNVEAWS 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CprNP_477158.1 Flavodoxin_1 86..223 CDD:425562
CYPOR 281..678 CDD:99801 15/60 (25%)
AT3G24710NP_189114.2 FNR_like <1..65 CDD:447143 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.