DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pez and Ptp61F

DIOPT Version :9

Sequence 1:NP_001260127.1 Gene:Pez / 33882 FlyBaseID:FBgn0031799 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:345 Identity:82/345 - (23%)
Similarity:139/345 - (40%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   927 TAGQHSKLAAKLKLAQDDLNLPNRWSTGVNKPQPISGRYSKDKLCQILDQKLSDSQL-FMEFERI 990
            |:|..|..||:|::..:..:...:|.           |:.|: :|:..|::..:.|. ..|.|| 
  Fly     6 TSGSGSAAAARLQIEAEYKDKGPQWH-----------RFYKE-ICETCDREAKEKQFSTSESER- 57

  Fly   991 PKRREHALYECALLEENEPKNHDPNFLPYDDNRVRLTPCRDNRHG---YVNASSISATVGTKQRF 1052
                          ..|...|...:..|||.:|:.|      :.|   |:||:.:.  :...:|.
  Fly    58 --------------HTNRGLNRYRDVNPYDHSRIVL------KRGSVDYINANLVQ--LERAERQ 100

  Fly  1053 YIVAQSPQEPLTMRIFWQCVWEADVYLVVQLTEDMS--------YIPRN---------SHQRL-- 1098
            ||:.|.|... |:..||..|||.....|:.|.:.|.        |.|..         .|.:|  
  Fly   101 YILTQGPLVD-TVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTV 164

  Fly  1099 EFGQFQVYQEFSQTTDRCTTIKLRLYHVPSRRYRSVWYLQYADWAEQNCPRDVNHFLDFLEELNS 1163
            |..:.:.||.|.:...:.|.::       :::.|.|....|..|.:...|...|.||.||:::..
  Fly   165 ELVRLETYQNFVRRWFKLTDLE-------TQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRD 222

  Fly  1164 VRLASTQEVPPGHNTNPPVLLHCLEGGGRSGVTLTADLLLYTLDHNEDLDIPRVIGQLRHQRDSI 1228
            ....| ::|       .|.::||..|.||||.....|..|..:|...:.::.:|:.:||..|..:
  Fly   223 SGCLS-RDV-------GPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRMGL 279

  Fly  1229 IPSLAQYKFIYNLLITYLKR 1248
            |.:..|..|.|..:|..:|:
  Fly   280 IQTADQLDFSYQAIIEGIKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PezNP_001260127.1 B41 26..230 CDD:214604
FERM_N 26..93 CDD:286467
FERM_M 114..230 CDD:278785
FERM_C_PTPN14_PTPN21 225..317 CDD:270009
Y_phosphatase 1007..1243 CDD:278528 65/257 (25%)
PTPc 1009..1243 CDD:238006 64/255 (25%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 72/300 (24%)
PTPc 62..295 CDD:238006 64/256 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.