DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pez and Ptp36E

DIOPT Version :9

Sequence 1:NP_001260127.1 Gene:Pez / 33882 FlyBaseID:FBgn0031799 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster


Alignment Length:380 Identity:107/380 - (28%)
Similarity:173/380 - (45%) Gaps:64/380 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   890 SSAASKDLKRKKRWNFLSRS--KTPDKQKSATLGREKATTAGQHSKLAAKLKLAQDDLN-----L 947
            |||...|:::::|   .||:  ..|:..|.:.|      .:|..|....||: |:|:.|     :
  Fly    24 SSARYDDVEKQQR---KSRAIVSIPNTIKLSML------NSGLLSFERIKLE-ARDENNSLSKTI 78

  Fly   948 PNRWSTGVNKPQPISGRYSKDKLCQILDQKLSDSQLF-MEFERIPKRREHALYEC--ALLEENEP 1009
            ||         .||..|:.. |||   |.:.....|: :||:...|...:.   |  ||.:.|..
  Fly    79 PN---------GPIDIRHFL-KLC---DLRRKFPVLYKLEFQTAAKVESNT---CRHALKKNNLE 127

  Fly  1010 KNHDPNFLPYDDNRV---RLTPCRDNRHGYVNASSISATVGTKQRFYIVAQSPQEPLTMRIFWQC 1071
            ||.:|..:|||.|||   ::...:|:  .|||||.:.:.:  |...|||.|.|.|. |::.:|:.
  Fly   128 KNQNPKCIPYDYNRVVLEKVGGLQDS--DYVNASYVDSLL--KPNAYIVTQGPVEE-TVQAYWRM 187

  Fly  1072 VWEADVYLVVQLTEDM--------SYIPRNSHQRLEFGQ--FQVYQEFSQTTDRCTTIKLRLYHV 1126
            ||:.::..:|.||:..        .|.|.|.....::|.  ..:.:|.........|  .|||.:
  Fly   188 VWQENISAIVMLTKTFDFAKVMCHQYWPPNMEVHEQYGDIFINIVREEQLANFHIRT--FRLYKM 250

  Fly  1127 PSRR----YRSVWYLQYADWAEQNCPRDVNHFLDFLEELNSVRLASTQEVPPGHNTNPPVLLHCL 1187
            ..::    .|.:....|.:|...:||.. |..|:|...   |||.....:....:...|:|:||.
  Fly   251 NEKQEVTDERLILQFHYTEWYSHSCPFS-NALLEFRRR---VRLVVGNIIKDEDDMRGPILVHCS 311

  Fly  1188 EGGGRSGVTLTADLLLYTLDHNEDLDIPRVIGQLRHQRDSIIPSLAQYKFIYNLL 1242
            :|||||||.::.|..|...:..|..::...:.:||..|..::.::.||||||:.|
  Fly   312 DGGGRSGVYMSIDANLELAEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDTL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PezNP_001260127.1 B41 26..230 CDD:214604
FERM_N 26..93 CDD:286467
FERM_M 114..230 CDD:278785
FERM_C_PTPN14_PTPN21 225..317 CDD:270009
Y_phosphatase 1007..1243 CDD:278528 74/253 (29%)
PTPc 1009..1243 CDD:238006 73/251 (29%)
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 74/253 (29%)
Y_phosphatase 428..671 CDD:395053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.