DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pez and K07F5.8

DIOPT Version :9

Sequence 1:NP_001260127.1 Gene:Pez / 33882 FlyBaseID:FBgn0031799 Length:1252 Species:Drosophila melanogaster
Sequence 2:NP_501766.1 Gene:K07F5.8 / 177833 WormBaseID:WBGene00010636 Length:284 Species:Caenorhabditis elegans


Alignment Length:278 Identity:59/278 - (21%)
Similarity:107/278 - (38%) Gaps:82/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1022 NRVRLTPCRDNR---------HGYVNASSISATVGTKQRFYIVAQSPQEPLTMRIFWQCVWEADV 1077
            ||.:...|.||.         |.|::|:.:|.....|:  :|..|:|.|. |...||....:..|
 Worm    22 NRYKDVGCLDNNRVKLGGAWPHEYIHANYVSTPTNPKR--FICTQAPLEK-TCADFWFMCLQDRV 83

  Fly  1078 YLVVQL----------------TED----MSYIPRNSHQRLEFGQFQVYQEFSQTTDR------- 1115
            ..:..|                |||    ||:..:.....::|...:..:....:..:       
 Worm    84 ETIFMLCNYKEKGAKKCHEYLPTEDNKDTMSFKEKGQKVTVKFESSKAIKFRDNSAAKVTKTVLT 148

  Fly  1116 -----CTTIKLRLYHVPSRRYRSVWYLQYADWAEQNCPRDVNHFLDFLEELNSVRLASTQEVPPG 1175
                 |..:|:..||             :.||.::..|...|..|:.||:         ..|..|
 Worm   149 VEGAGCDKLKVNHYH-------------WIDWPDRGVPTADNAILELLEK---------ARVSKG 191

  Fly  1176 HNTNPPVLLHCLEGGGRSGVTLTADLLLYTLDH------NEDLDIPRVIGQLRHQRDSIIPSLAQ 1234
                 |:.:||..|.||:|..:   :|.|.:|.      .||.|  ::|.::|.||::.:.:..|
 Worm   192 -----PIAVHCSAGIGRTGSVV---MLEYVMDQLLAGQIIEDTD--KIIQKIREQRNNSVQTDHQ 246

  Fly  1235 YKFIYNLLITYLKRTRLI 1252
            |.|::.:::.:.::..|:
 Worm   247 YLFVHQVMMNFFEKRGLL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PezNP_001260127.1 B41 26..230 CDD:214604
FERM_N 26..93 CDD:286467
FERM_M 114..230 CDD:278785
FERM_C_PTPN14_PTPN21 225..317 CDD:270009
Y_phosphatase 1007..1243 CDD:278528 58/267 (22%)
PTPc 1009..1243 CDD:238006 58/267 (22%)
K07F5.8NP_501766.1 Y_phosphatase 19..256 CDD:278528 58/268 (22%)
PTPc 20..256 CDD:238006 58/268 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.