DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDZ-GEF and Rasgef1c

DIOPT Version :9

Sequence 1:NP_609012.2 Gene:PDZ-GEF / 33881 FlyBaseID:FBgn0265778 Length:1573 Species:Drosophila melanogaster
Sequence 2:NP_001334391.1 Gene:Rasgef1c / 74563 MGIID:1921813 Length:469 Species:Mus musculus


Alignment Length:327 Identity:89/327 - (27%)
Similarity:145/327 - (44%) Gaps:70/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   747 STQSHLLPDYPDHVLKVYKADQTCKYVLIYKETTAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDG 811
            ||..||    .|.|.::...|:|       ..:..|:::....|:.             .|:|.|
Mouse   132 STIGHL----TDVVGRISPCDET-------YGSRVHQLLQTLHQKL-------------ASLGQG 172

  Fly   812 GMVKQRRLPDQLQNLAERISFAARYYLKLNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQL 876
                    |:.|....:.||:          .|:|  |..:..||:...:      :.|.||.||
Mouse   173 --------PESLVGADKPISY----------RTKP--PASIHRELLGVCS------DPYTLAQQL 211

  Fly   877 TLQDFANFRQIESTEYV------DELFELRSRYG--VPMLSKFAELVNREMFWVVSEICAEHNIV 933
            |..:....|.|...|:|      |.|...:.|:.  ...:..:.:..||..:.|.:|||......
Mouse   212 THVELERLRHIGPEEFVQAFVNKDPLAGTKPRFSDKTNNVEAYVKWFNRLCYLVATEICMPAKKK 276

  Fly   934 RRMKIVKQFIKIARHCKECRNFNSMFAIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPS 998
            :|.::::.||.:||.|....||||:.||:||:....||||::||.|:  |..:.| .|:..|||:
Mouse   277 QRAQVIEFFIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWAKV--KTAKFF-ILEHQMDPT 338

  Fly   999 RNMSKYR--------QLVSAELLAQHPIIPFYPIVKKDLTFIHLGNDTRV-DGLINFEKLRMLAK 1054
            .|...||        :.::|....:..:|||:.::.||:.|::.|...|: :|.:||||...|||
Mouse   339 GNFCNYRTALRGAAHRSLTAHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAK 403

  Fly  1055 EV 1056
            :|
Mouse   404 QV 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDZ-GEFNP_609012.2 CAP_ED 128..237 CDD:237999
RasGEFN 279..400 CDD:214571
PDZ_signaling 404..494 CDD:238492
DegQ <422..494 CDD:223343
PDZ_GEF_RA 757..841 CDD:176380 13/83 (16%)
RasGEF 871..1050 CDD:279011 62/195 (32%)
Rhomboid_SP 1252..>1357 CDD:289371
Rasgef1cNP_001334391.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.