DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDZ-GEF and rasgef1a

DIOPT Version :9

Sequence 1:NP_609012.2 Gene:PDZ-GEF / 33881 FlyBaseID:FBgn0265778 Length:1573 Species:Drosophila melanogaster
Sequence 2:XP_012822158.1 Gene:rasgef1a / 734010 XenbaseID:XB-GENE-5739365 Length:485 Species:Xenopus tropicalis


Alignment Length:255 Identity:66/255 - (25%)
Similarity:115/255 - (45%) Gaps:53/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   872 LAIQLTLQDFANFRQI------ESTEYVDELFELRSRYGVPMLSKFAELVNREMF--W------- 921
            ||.|||..:......|      :...::|.|...:.|      |...:..|.|.:  |       
 Frog   222 LAQQLTTIELERLGNIFPEDLMQIISHMDSLDNHKCR------SDVTKTYNLEAYDNWFNCLSML 280

  Fly   922 VVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMFAIVSGLGHGAVSRLRQTWEKLPSKYQR 986
            |.:|||......:|.::::.||.:||.|....|||||.||:||:....|:||::||.|:.:   .
 Frog   281 VATEICKVVKKKQRTRVMEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVKT---A 342

  Fly   987 LFNDLQDLMDPSRNMSKYRQLV--------SAELLAQHPIIPFYPIVKKDLTFIHLGNDTRV-DG 1042
            .|:.|:..||||.|...||..:        ||....:..:||.:.:..||:.|:|..:..|: :|
 Frog   343 KFDVLEHHMDPSSNFCNYRTALQGATQRSQSANSSREKIVIPVFNLFIKDIFFLHKIHSNRLPNG 407

  Fly  1043 LINFEKLRMLAKEV-----------------RLLTHMCSSPY---DLLSILELKGQSPSN 1082
            .|||:|...:::::                 ::.|::.::|.   :.|.:...:.:.|.|
 Frog   408 HINFKKFWEISRQIHDFLTWKQVECPYEKDKKIQTYLLTTPIYTEEALFLASFENEGPDN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDZ-GEFNP_609012.2 CAP_ED 128..237 CDD:237999
RasGEFN 279..400 CDD:214571
PDZ_signaling 404..494 CDD:238492
DegQ <422..494 CDD:223343
PDZ_GEF_RA 757..841 CDD:176380
RasGEF 871..1050 CDD:279011 61/201 (30%)
Rhomboid_SP 1252..>1357 CDD:289371
rasgef1aXP_012822158.1 REM 51..168 CDD:100121
RasGEF 218..465 CDD:214539 64/251 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.