DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDZ-GEF and Rasgef1a

DIOPT Version :9

Sequence 1:NP_609012.2 Gene:PDZ-GEF / 33881 FlyBaseID:FBgn0265778 Length:1573 Species:Drosophila melanogaster
Sequence 2:NP_001349032.1 Gene:Rasgef1a / 70727 MGIID:1917977 Length:498 Species:Mus musculus


Alignment Length:468 Identity:102/468 - (21%)
Similarity:181/468 - (38%) Gaps:119/468 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   714 GSDAGGNGGGRLQVNYLNAHIHRPSAASTLTTNSTQS---HLLPD---YPDHVL--------KVY 764
            |...||...|...:.:.:..         ||:.|.::   ||:|.   |||...        :|:
Mouse    33 GERGGGASSGSKDLIFQDGR---------LTSGSLEALMEHLVPTVDYYPDRTYIFTFLLSSRVF 88

  Fly   765 --------KADQTC---------------------KYVLIYKETT-------AHEVVMLTLQEFG 793
                    :..|.|                     |.|.:.||.|       ..|.||..|:.. 
Mouse    89 MPPHDLLARVGQICLEQRQQLEAGPEKAKLKSFSTKIVQLLKEWTEAFPYDFQDEKVMAELKAI- 152

  Fly   794 IHDPSSNFSLCEVSV------GDGGMVKQRRLPDQLQNLAERISFAARYYL-KLNDSTEPLVPDE 851
                :...:.|:..:      .:.|.|| :.:...:|:|.  :|.|||..| :|.:.....|.|:
Mouse   153 ----AHRVTQCDEYLMQPRPSQENGTVK-KAIAQMIQSLL--LSLAARSQLQELREKLRSPVVDK 210

  Fly   852 ----LALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTE------YVDELFELRSRYGVP 906
                .|.....:.::..:..:...||.|||..:......|...:      ::|.|...|.|..:.
Mouse   211 GPVLKAKPPAAQKDILGVCSDPLVLAQQLTHIELERVNSIRPEDLMQIISHMDSLDNHRCRGDMT 275

  Fly   907 ---MLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMFAIVSGLGHG 968
               .|..:....|.....|.:|:|.......|.::::.||.:||.|....|||||.||:||:...
Mouse   276 KTFSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRMLEFFIDVARECFNIGNFNSMMAIISGMNLS 340

  Fly   969 AVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLV--------SAELLAQHPIIPFYPIV 1025
            .|:||::||.|:.:   ..|:.|:..||||.|...||..:        :|....:..:||.:.:.
Mouse   341 PVARLKKTWSKVKT---AKFDVLEHHMDPSSNFCNYRTALQGATQRSQTANSSREKIVIPVFNLF 402

  Fly  1026 KKDLTFIH-LGNDTRVDGLINFEKLRMLAKEV-----------------RLLTHMCSSPY---DL 1069
            .||:.|:| :..:...:|.|||:|...:::::                 ::.:::.::|.   :.
Mouse   403 VKDIYFLHKIHTNHLPNGHINFKKFWEISRQIHEFMTWTQVECPFEKDKKIQSYVLTAPIYSEEA 467

  Fly  1070 LSILELKGQSPSN 1082
            |.|...:.:.|.|
Mouse   468 LFIASFESEGPEN 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDZ-GEFNP_609012.2 CAP_ED 128..237 CDD:237999
RasGEFN 279..400 CDD:214571
PDZ_signaling 404..494 CDD:238492
DegQ <422..494 CDD:223343
PDZ_GEF_RA 757..841 CDD:176380 25/134 (19%)
RasGEF 871..1050 CDD:279011 57/196 (29%)
Rhomboid_SP 1252..>1357 CDD:289371
Rasgef1aNP_001349032.1 REM 57..163 CDD:100121 20/110 (18%)
RasGEF 235..427 CDD:306970 56/194 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.