DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDZ-GEF and Gm6408

DIOPT Version :9

Sequence 1:NP_609012.2 Gene:PDZ-GEF / 33881 FlyBaseID:FBgn0265778 Length:1573 Species:Drosophila melanogaster
Sequence 2:NP_001230033.1 Gene:Gm6408 / 623198 MGIID:3779591 Length:320 Species:Mus musculus


Alignment Length:324 Identity:62/324 - (19%)
Similarity:108/324 - (33%) Gaps:103/324 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 TPERLLQQL------VEENS--------MTDPTY-----VEDFLLTHRIFI--------QNPQEV 324
            :||.::|.:      |:.|.        ...|:|     |.|.|:|...|.        :..:.:
Mouse    66 SPEYVVQMIHYIPAAVQHNDHVCIRIFLAMYPSYASTWKVLDLLMTTYAFFLPDRIKDQETKRAI 130

  Fly   325 TSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNHFTDFEADYEMMEFLEVFEALLERKKLLSQ 389
            ...|.|||.....|.:::.:|  .|.|..:.:|.::....:.|.:..|.|.|    ||.::.:..
Mouse   131 FRFLFHWFKKFPKDFYESPDL--AVVRQFIDYVRHNVPSADEDTQARELLSV----LEEQEAIGL 189

  Fly   390 LRLLHIACAAKARMRSCTLTRSSRDEPLNFRIVGGYELRGVAIATGNAAVGIYISHVEPGSKAQD 454
            ......|.|.:...:..    |.|.|.|..|                           |.|:.:.
Mouse   190 NPEEDFATAPEPSEQDA----SGRQETLAPR---------------------------PASETEP 223

  Fly   455 VGLKRGDQIHE-VNGQSLDHVTSKRALEILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGS 518
            .|.|:..:..| |.|..||....|..:| |..:.|                ||:....||.....
Mouse   224 QGDKQPREDPELVKGAVLDPSEPKATIE-LPPSLH----------------QAVPTSDGTLSPVD 271

  Fly   519 ISAGSGSFKSVRSPRRICANDIAKLHGRSDSTTDELSSVSASNR---AHMVRLSSVDMLLDQPD 579
            ::|..             |..:|     :|...|..:.||.:.:   ::.|:|.:.|.::..|:
Mouse   272 VTADE-------------ATGVA-----ADEAADVAADVSPARQLFVSYTVQLGTPDFVIPLPE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDZ-GEFNP_609012.2 CAP_ED 128..237 CDD:237999
RasGEFN 279..400 CDD:214571 29/139 (21%)
PDZ_signaling 404..494 CDD:238492 18/90 (20%)
DegQ <422..494 CDD:223343 13/72 (18%)
PDZ_GEF_RA 757..841 CDD:176380
RasGEF 871..1050 CDD:279011
Rhomboid_SP 1252..>1357 CDD:289371
Gm6408NP_001230033.1 REM 89..183 CDD:100121 21/99 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3629
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.