DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDZ-GEF and RGL4

DIOPT Version :9

Sequence 1:NP_609012.2 Gene:PDZ-GEF / 33881 FlyBaseID:FBgn0265778 Length:1573 Species:Drosophila melanogaster
Sequence 2:NP_001316353.1 Gene:RGL4 / 266747 HGNCID:31911 Length:580 Species:Homo sapiens


Alignment Length:218 Identity:51/218 - (23%)
Similarity:92/218 - (42%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   872 LAIQLTLQDFANFRQIESTEYVDELF---ELR-SRYGVPMLSKFAELVNREMFWVVSEICAEHNI 932
            ||.||||.|...|:::...|.:..::   .|: :.:..|.:.......||....:.:....:|::
Human   223 LAEQLTLMDAELFKKVVLHECLGCIWGQGHLKGNEHMAPTVRATIAHFNRLTNCITTSCLGDHSM 287

  Fly   933 VR--RMKIVKQFIKIARHCKECRNFNSMFAIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDL---- 991
            ..  |.::|:.:||:||.|....||:|:..|||.|....:.:|.:||..:.||..:...:|    
Human   288 RARDRARVVEHWIKVARECLSLNNFSSVHVIVSALCSNPIGQLHKTWAGVSSKSMKELKELCKKD 352

  Fly   992 ----QDLM-------------DPSRNMSKYRQLVSAELLAQHPIIPFYPIVKKDLTFIHLGNDTR 1039
                :||:             :|.|...:.|:       .:..::||......:|..:.......
Human   353 TAVKRDLLIKAGSFKVATQERNPQRVQMRLRR-------QKKGVVPFLGDFLTELQRLDSAIPDD 410

  Fly  1040 VDGLINFEKLRMLAKEVRLLTHM 1062
            :||..|     ..:||||:|..|
Human   411 LDGNTN-----KRSKEVRVLQEM 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDZ-GEFNP_609012.2 CAP_ED 128..237 CDD:237999
RasGEFN 279..400 CDD:214571
PDZ_signaling 404..494 CDD:238492
DegQ <422..494 CDD:223343
PDZ_GEF_RA 757..841 CDD:176380
RasGEF 871..1050 CDD:279011 45/204 (22%)
Rhomboid_SP 1252..>1357 CDD:289371
RGL4NP_001316353.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3629
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.