DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDZ-GEF and Gm4871

DIOPT Version :10

Sequence 1:NP_609012.2 Gene:PDZ-GEF / 33881 FlyBaseID:FBgn0265778 Length:1573 Species:Drosophila melanogaster
Sequence 2:NP_001094933.1 Gene:Gm4871 / 231885 MGIID:3648713 Length:314 Species:Mus musculus


Alignment Length:139 Identity:36/139 - (25%)
Similarity:48/139 - (34%) Gaps:21/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LLQQLVEENSMTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLL 355
            :|..|::......|...:|.|....||        :.|.||  |:....|........|.|.::.
Mouse    98 VLDLLMKTYPSFQPDCEQDQLTKSAIF--------NFLAHW--LDTFPEHFFDSPNLAVMRQLMD 152

  Fly   356 WVNNHFTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR 420
            :...|....|.|.|..|.|...|. .|.|||     .|...|||.|...:     |...|.|..|
Mouse   153 YAGRHMPSAEFDKESRELLSRLEE-QEAKKL-----KLEKDCAATAEQDA-----SRMQENLALR 206

  Fly   421 IVGGYELRG 429
            :....|.:|
Mouse   207 LASVAEPQG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDZ-GEFNP_609012.2 CAP_ED 128..237 CDD:237999
RasGEFN 279..400 CDD:214571 28/108 (26%)
PDZ_RapGEF2_RapGEF6-like 404..496 CDD:467237 6/26 (23%)
RA_PDZ-GEF1 759..841 CDD:340483
RasGEF 871..1050 CDD:459872
Gm4871NP_001094933.1 REM 63..176 CDD:100121 20/87 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.