Sequence 1: | NP_609012.2 | Gene: | PDZ-GEF / 33881 | FlyBaseID: | FBgn0265778 | Length: | 1573 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002938727.2 | Gene: | zbtb22 / 100488727 | XenbaseID: | XB-GENE-6458515 | Length: | 436 | Species: | Xenopus tropicalis |
Alignment Length: | 198 | Identity: | 42/198 - (21%) |
---|---|---|---|
Similarity: | 57/198 - (28%) | Gaps: | 82/198 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 1160 CEPAHGSTYSGSISHGNTSH-------------------RSGGGGSISGGAGGSSGGGGGGSSSL 1205
Fly 1206 NAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNNGPKFGTASPQA 1270
Fly 1271 VKKMLSLSESSKIRPHQPFVPRHGSTMAGVIP----------------PLHHMHAAHGFSTPSPG 1319
Fly 1320 GVV 1322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PDZ-GEF | NP_609012.2 | CAP_ED | 128..237 | CDD:237999 | |
RasGEFN | 279..400 | CDD:214571 | |||
PDZ_signaling | 404..494 | CDD:238492 | |||
DegQ | <422..494 | CDD:223343 | |||
PDZ_GEF_RA | 757..841 | CDD:176380 | |||
RasGEF | 871..1050 | CDD:279011 | |||
Rhomboid_SP | 1252..>1357 | CDD:289371 | 18/87 (21%) | ||
zbtb22 | XP_002938727.2 | BTB_POZ_ZBTB22_BING1 | 12..123 | CDD:349519 | |
C2H2 Zn finger | 339..358 | CDD:275368 | 7/51 (14%) | ||
zf-H2C2_2 | 352..374 | CDD:372612 | 9/50 (18%) | ||
zf-C2H2 | 364..386 | CDD:333835 | 7/33 (21%) | ||
C2H2 Zn finger | 366..386 | CDD:275368 | 6/29 (21%) | ||
zf-H2C2_2 | 378..401 | CDD:372612 | 6/25 (24%) | ||
C2H2 Zn finger | 394..418 | CDD:275368 | 2/23 (9%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |