DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDZ-GEF and zbtb22

DIOPT Version :9

Sequence 1:NP_609012.2 Gene:PDZ-GEF / 33881 FlyBaseID:FBgn0265778 Length:1573 Species:Drosophila melanogaster
Sequence 2:XP_002938727.2 Gene:zbtb22 / 100488727 XenbaseID:XB-GENE-6458515 Length:436 Species:Xenopus tropicalis


Alignment Length:198 Identity:42/198 - (21%)
Similarity:57/198 - (28%) Gaps:82/198 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1160 CEPAHGSTYSGSISHGNTSH-------------------RSGGGGSISGGAGGSSGGGGGGSSSL 1205
            |||:.|..|....  |.:.:                   .||.|.:..||:|.|.||.||.....
 Frog   277 CEPSDGMPYEEGA--GGSGYPQGPPLLPLDMQGNQLLVLPSGHGAAGQGGSGTSPGGEGGKIFLC 339

  Fly  1206 NAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNNGPKFGTASPQA 1270
            :.|   ..:||.          |:|.||.:                    ||.|...|.  .|..
 Frog   340 HCG---KAFSHK----------SMRDRHVN--------------------MHLNLRPFD--CPVC 369

  Fly  1271 VKKMLSLSESSKIRPHQPFVPRHGSTMAGVIP----------------PLHHMHAAHGFSTPSPG 1319
            .||.       |::.|   :..|..|..||.|                ..|..|........:.|
 Frog   370 GKKF-------KMKHH---LTEHMKTHTGVKPYECEVCAKKFMWRDSFMRHRGHCERRHRATAGG 424

  Fly  1320 GVV 1322
            |::
 Frog   425 GII 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDZ-GEFNP_609012.2 CAP_ED 128..237 CDD:237999
RasGEFN 279..400 CDD:214571
PDZ_signaling 404..494 CDD:238492
DegQ <422..494 CDD:223343
PDZ_GEF_RA 757..841 CDD:176380
RasGEF 871..1050 CDD:279011
Rhomboid_SP 1252..>1357 CDD:289371 18/87 (21%)
zbtb22XP_002938727.2 BTB_POZ_ZBTB22_BING1 12..123 CDD:349519
C2H2 Zn finger 339..358 CDD:275368 7/51 (14%)
zf-H2C2_2 352..374 CDD:372612 9/50 (18%)
zf-C2H2 364..386 CDD:333835 7/33 (21%)
C2H2 Zn finger 366..386 CDD:275368 6/29 (21%)
zf-H2C2_2 378..401 CDD:372612 6/25 (24%)
C2H2 Zn finger 394..418 CDD:275368 2/23 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.