DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL2 and AANATL3

DIOPT Version :9

Sequence 1:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_610018.1 Gene:AANATL3 / 35285 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster


Alignment Length:221 Identity:89/221 - (40%)
Similarity:132/221 - (59%) Gaps:15/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVD-- 66
            ||||.||..||..|:|||..:||:.|||.....|: .||:......|.|.|:|.|...|||:|  
  Fly     9 ITIRTMTKEDYPSVKAFLKDNFFQSEPLCQSTSEN-VQSQNEKENDEYHLSMIAQGTCLVAIDES 72

  Fly    67 -GERIVGVVLAGELVPEDLEREYQEAEQKE-----ITCLLDKIHKFLAGIERQANIFKHYGVERA 125
             |.:.||:||||...|||||:...|||..|     ..|::      |:.|||:||:|:.:|:.:.
  Fly    73 NGGKFVGLVLAGAQYPEDLEKHRIEAESMEQHFWARACIM------LSKIEREANLFERFGISKL 131

  Fly   126 LYLYMLGVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYAD 190
            ||.::..|:.|:|.:.:|:||....:::||.:|||.:|:.|::..|.|...||.|:|:.:..|||
  Fly   132 LYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALGMKCVHSLPYAD 196

  Fly   191 YKDEHGEIVLRASEPHTSASVVAIRL 216
            |||:.|..:...:||||.|.::.|:|
  Fly   197 YKDDQGRPIFTPAEPHTMARIMFIKL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 17/48 (35%)
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 19/59 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435016
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I7474
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 1 1.000 - - FOG0007623
OrthoInspector 1 1.000 - - mtm9663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.