DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL2 and CG17375

DIOPT Version :9

Sequence 1:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_609076.3 Gene:CG17375 / 33956 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster


Alignment Length:179 Identity:32/179 - (17%)
Similarity:75/179 - (41%) Gaps:47/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DYEEVEAFLAVHFFKQE-PLMLIPQEDPKQSEVSSAE---AELHR-----SLIPQDL--SLVAVD 66
            |.::..::...|..:.| .:|:|.:::.:...|...|   .|.|.     |.:|::|  .::.:.
  Fly    57 DMKQTYSWYVRHILRNECSVMMISEDETQIRAVGLLEWMTEEWHSWVFFPSSLPRNLFQQIIMMK 121

  Fly    67 GERI------VGV-----VLAGELV-PEDL--EREYQEAEQKEITCLLDKIHKFLAGIERQANIF 117
            .|.|      :|:     :...|:. |::|  .|::       ::.:.| :..|:|         
  Fly   122 KELIDATKANMGISTYDALFVHEIAFPDELYFNRDF-------LSTIFD-VFGFVA--------- 169

  Fly   118 KHYGVERALYLYMLGVDVS----IRRQRVGTRLVEATIELGRQRGFPVV 162
            :|..:.|..::.:..||..    |..:.:| |.:.:..::|..|.|.::
  Fly   170 QHMHMPRVSFIALSSVDQEAASLIDYEEIG-RTIYSIYKVGNTRPFDIL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 10/53 (19%)
CG17375NP_609076.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.