DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL2 and CG31493

DIOPT Version :9

Sequence 1:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_731135.2 Gene:CG31493 / 318765 FlyBaseID:FBgn0051493 Length:246 Species:Drosophila melanogaster


Alignment Length:193 Identity:40/193 - (20%)
Similarity:78/193 - (40%) Gaps:30/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAE-AELHRSLIPQDLSLVA--VDGERIVGVVL 75
            |:|||..|.......|...:|.:  .|.|.::.|| .:|.|.:|.:.:|...  |:..|||..: 
  Fly    22 YDEVEELLVNISINYEFGCVIAK--LKDSPLAIAELGKLIRHIISRGISFAIRHVESGRIVAAI- 83

  Fly    76 AGELVPEDLEREYQE--AEQKEITCLLDKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIR 138
            |..:.....:..|.:  |:.|....:  |..:....::...|:.:|..|:....:..:......|
  Fly    84 ANIIFNTKRKTSYYDICAQIKSPNMI--KYMELWDAVDASFNVNEHCQVDSTGDVEYMATLPEFR 146

  Fly   139 RQRVGTRLVEATIE---LGRQRGFPV-----------------VTSTCSNQNSKRLMTALNME 181
            |:.:|..|.:.:|:   |..||..|:                 :.:..::|:|:.:...|.|:
  Fly   147 RRGLGHILCQQSIQFASLLAQRKLPLEILNQLPEEMRIERPQAIVAITTSQSSQIMGRQLGMK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 12/68 (18%)
CG31493NP_731135.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.