DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL2 and R13D11.4

DIOPT Version :9

Sequence 1:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_503329.2 Gene:R13D11.4 / 187863 WormBaseID:WBGene00020058 Length:227 Species:Caenorhabditis elegans


Alignment Length:219 Identity:49/219 - (22%)
Similarity:87/219 - (39%) Gaps:53/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTIGDYEEVEAFLAVHFFKQEPL-----MLIPQEDPKQSEVSSAEAELHRSL-IPQDLSLVAVDG 67
            :|..:..|:..||..||..:||:     |......|...::      ..|:| ||...:||..|.
 Worm    11 LTNENSSELSEFLMSHFLLEEPMNRAIGMSRENFQPFVDKL------FERTLNIPFSFALVEKDS 69

  Fly    68 ERIVGVVLA-------GELVPEDLEREYQE-----AEQKEITC---LLDKIH-KFLAGIERQANI 116
            .:.....::       .::..:|.|....|     .|:|:|..   :|.::| ||....      
 Worm    70 RKFAACAMSSLWINEKNDVAHKDTENHGDEFTFGNPERKDIAAVGKILTELHGKFFEIC------ 128

  Fly   117 FKHYGVERALYLYMLGVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNME 181
               ..||:||:|.:|.|....:|:.:.:||:....:..:.|.|     .||...|:  :::|..:
 Worm   129 ---LDVEQALHLEILSVAKEHQRRGLASRLMAKMEDPAKMREF-----KCSKIASE--ISSLANQ 183

  Fly   182 CILTKD---------YADYKDEHG 196
            |::.|.         :|...||.|
 Worm   184 CLMKKRGYTALTETLFASECDESG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 12/48 (25%)
R13D11.4NP_503329.2 Acetyltransf_1 <130..191 CDD:366181 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.