DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL2 and M7.12

DIOPT Version :9

Sequence 1:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_502070.2 Gene:M7.12 / 187458 WormBaseID:WBGene00010887 Length:241 Species:Caenorhabditis elegans


Alignment Length:199 Identity:40/199 - (20%)
Similarity:77/199 - (38%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVA--VDGERIVGVVLAGE 78
            ||..||..:|..:|||.  ......:|::.|....:...::..::|::|  ...:.|||.:|...
 Worm    36 EVVDFLNNNFRVEEPLS--KAAGMTESDIQSCFDGVFERVLKNEVSILARSKQSDEIVGCMLNSV 98

  Fly    79 LVPEDLEREYQEAEQKE----------ITCLLDKIHKFLAGIERQANIFKHYGVERALYLYMLGV 133
            ....|.::...|||..|          |..:|:::|:....:....:...|:.:.        .|
 Worm    99 WKRNDPKKNEDEAEDFEFGGDRKGVMTIGEILNELHESFWKLRPDQHTVLHFEIS--------SV 155

  Fly   134 DVSIRRQRVGTRL------------VEAT------IELGRQ-----RGFPVVTSTCSNQ----NS 171
            :.:.:||.:.::.            |||:      ..|..|     ||:..|.||..:.    |.
 Worm   156 NKNHQRQGLASKFMNWTEKKELLKSVEASSIVAEASSLANQILLSKRGYETVASTLLSSRIDVNG 220

  Fly   172 KRLM 175
            |:::
 Worm   221 KQIL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 11/71 (15%)
M7.12NP_502070.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.