DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL2 and R05H10.1

DIOPT Version :9

Sequence 1:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 / 175144 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans


Alignment Length:217 Identity:47/217 - (21%)
Similarity:89/217 - (41%) Gaps:44/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAE-----AELHRSLIPQDLSLVAV--DGERI 70
            |::.:..|||.||:.:||.:       :.|:::..|     .|:..|.:...:|.|..  |||.|
 Worm    14 DFDRILKFLAEHFYHEEPSI-------RASKIALEEWLPIFGEMTTSSLKLPISTVVTTEDGENI 71

  Fly    71 VGVVL----AGELVPEDLER-------------EYQEAEQKEITCLLDKIH-KFLAGIERQANIF 117
            |.|:|    :.|   ||.||             .|.||.|:.:| ::.|.| :|........|: 
 Worm    72 VAVLLNSMWSRE---EDEERMKHGNGKGDHDTSGYSEALQRFMT-IVQKCHDEFWNLAPSDVNL- 131

  Fly   118 KHYGVERALYLYMLGVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMEC 182
                   .:|..:..|....:||.:.|:::...:...|......:.|..|:..::.|:.....:|
 Worm   132 -------VVYREISSVGKPWQRQGIATKMLSRNMSAARLHNVDGIVSATSSFANQTLLAKNGFQC 189

  Fly   183 ILTKDYADYKDEHGEIVLRASE 204
            :....|:.....:|:.::...:
 Worm   190 LKEFPYSGIVSSNGDKLVETDD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 7/48 (15%)
R05H10.1NP_497076.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.