DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and FRK1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_015184.1 Gene:FRK1 / 855962 SGDID:S000006062 Length:865 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:102/301 - (33%)
Similarity:167/301 - (55%) Gaps:32/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSE----------EYGKRVAVKIISKVK 111
            |.:.|::.:...|.   ...|||..:|.|.:.|||:|:.:          ::.|:||:|:|.:..
Yeast    25 PQRTDEQRRKHVTF---GPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDS 86

  Fly   112 APSEYTQKF-LPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQ 175
            ..::|.::. :.|||.|:|.|.|.|::...:.::.|..:.::::.|..|....|:::::.|.|..
Yeast    87 ISNDYRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKEMN 151

  Fly   176 SRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCG 240
            :..||.||:|.|.||||||:||||:|.||||||:|.||.:.||||..:....::    |.||.||
Yeast   152 ACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNE----LMKTSCG 212

  Fly   241 SYAYASPE-ILKGVAYDPFMSDIWACGVVCYAMVFGRLPYD-------GSNVHILLKRINQS-LV 296
            |..||:|| ::....|:...:|||:|||:.||::.|.||:|       ||::..|...||.: |.
Yeast   213 SPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLK 277

  Fly   297 FPK--SPSASSECKHMIMHILAPVKIRYNIPQVKEDPWYSP 335
            ||.  .|......:.|   :::..|.|.|:.|:|:..|..|
Yeast   278 FPDYILPIPRDLLRRM---LVSDPKKRINLKQIKKHEWLKP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 97/279 (35%)
S_TKc 78..332 CDD:214567 96/275 (35%)
FRK1NP_015184.1 PKc_like 39..313 CDD:419665 97/280 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.