DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and NPR1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_014216.1 Gene:NPR1 / 855538 SGDID:S000005127 Length:790 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:81/338 - (23%)
Similarity:134/338 - (39%) Gaps:98/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GKVIGTGNYAKVKIGFSEEY---------GKRVAVKII-----SKVKAPSEYTQKFLPREIEAVK 129
            |..|.:.::....|.||:.|         |...:||:.     :|:.|..|:..||   |.|:.:
Yeast   418 GDTIYSHSHGGSGIPFSKRYIKTGADLGAGAGGSVKLAQRISDNKIFAVKEFRTKF---ENESKR 479

  Fly   130 G--------------LHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLF 180
            .              |:|.|:|...:.:..:.|:..:|:..|. .|...|...|...| :....|
Yeast   480 DYVKKITSEYCIGTTLNHPNIIETIEIVYENDRILQVMEYCEY-DLFAIVMSNKMSYE-EICCCF 542

  Fly   181 KQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYA 245
            ||:::.|:|:||.|:.|||:|.:|.:::|...:||||||.|...:......::.:....||..|.
Yeast   543 KQILTGVQYLHSIGLAHRDLKLDNCVINEKGIVKLIDFGAAVVFSYPFSKNLVEASGIVGSDPYL 607

  Fly   246 SPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPY------------------------------- 279
            :||:.....|||...|||:..::...|:..:.|:                               
Yeast   608 APEVCIFAKYDPRPVDIWSSAIIFACMILKKFPWKIPKLRDNSFKLFCSGRDCDSLSSLVTRTPD 672

  Fly   280 -----------------------DGSNVHILLKRINQSLVFPKSPSASSECKHMI--MHILAPVK 319
                                   |.:||:|..:|:..||        ..|.:|::  |..|||. 
Yeast   673 PPSYDESHSTEKKKPESSSNNVSDPNNVNIGPQRLLHSL--------PEETQHIVGRMIDLAPA- 728

  Fly   320 IRYNIPQVKEDPW 332
            .|.||.::.||||
Yeast   729 CRGNIEEIMEDPW 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 81/338 (24%)
S_TKc 78..332 CDD:214567 79/336 (24%)
NPR1NP_014216.1 PKc_like 451..742 CDD:419665 74/305 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.