DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and PRR1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_012806.1 Gene:PRR1 / 853744 SGDID:S000001599 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:85/336 - (25%)
Similarity:140/336 - (41%) Gaps:111/336 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 IGTGNYAKVKI----GFSEEYGKRVAVKIISKVKAPSEYT------------------QKFLPRE 124
            ||:||::.|.:    ..|....|:||||   ::|.|.|.:                  :..|.||
Yeast   198 IGSGNFSTVLLYELMDQSNPKLKQVAVK---RLKYPEELSNVEQINTSLRYKETLSRLENSLTRE 259

  Fly   125 IEAVKGLHHENLI--------TFYQS--------IETSHRV---YLIMQLAENGTLLDYVRERK- 169
            ::.:|.|:|..::        .|..|        |:|...:   .:||.....|.||..|..|. 
Yeast   260 LQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNG 324

  Fly   170 FLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWN----------------LKLIDF 218
            .|:....:.:|.::|.||:|:|...::|||:|.||:||..:::                ::|.||
Yeast   325 RLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADF 389

  Fly   219 GFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSN 283
            |..:|   ..:|::..::  |||..|.|||||.||.||..:||.||.||:.|::...|||:|   
Yeast   390 GLCKK---IENNEMCTAR--CGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFD--- 446

  Fly   284 VHILLKRINQSLVFPKSPSASSE---------------------------CKHMIMHILAPVKIR 321
                           ..|:||:.                           .|.::.:.|.....|
Yeast   447 ---------------PPPNASARQRSRATSHRIARFDWRWYRLSDYKTNVGKQIVENTLTRKNQR 496

  Fly   322 YNIPQVKEDPW 332
            ::|.::.|.|:
Yeast   497 WSINEIYESPF 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 85/336 (25%)
S_TKc 78..332 CDD:214567 84/334 (25%)
PRR1NP_012806.1 S_TKc 192..508 CDD:214567 85/336 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.