DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and KKQ8

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_012753.2 Gene:KKQ8 / 853686 SGDID:S000001651 Length:724 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:80/322 - (24%)
Similarity:129/322 - (40%) Gaps:59/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKI-----------GFSEEYGKRVAVKIISKV 110
            |.:...:..|  |..:.:|..:| ::|.|.|.:||:           .|...:..:.....:.::
Yeast   396 PAECIGEQAP--TFQDNYGHPVG-LVGAGAYGEVKLCARLRNEKDSPPFETYHDSKYIYYAVKEL 457

  Fly   111 K-APSEYTQKF---LPREIEAVKGLHH---------ENLITFYQSIETSHRVYLIMQLAENGTLL 162
            | .|....:||   :..|......|.|         .|::..:..:|.|.....:|:....|.|.
Yeast   458 KPKPDSDLEKFCTKITSEFIIGHSLSHYHKNGKKPAPNILNVFDILEDSSSFIEVMEFCPAGDLY 522

  Fly   163 D-YVRERKF---LDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARK 223
            . .|.:.|.   |...::....|||:..|:::|..|:.|.|:|.||:|...:..||:.|||.:..
Yeast   523 GMLVGKSKLKGRLHPLEADCFMKQLLHGVKFMHDHGIAHCDLKPENILFYPHGLLKICDFGTSSV 587

  Fly   224 DTRTSDNQVILSKTFCGSYAYASP-EILKGVAYDPFMSDIWACGVVCYAMVFGR----------- 276
            .....:.:|...|...||..|.:| |.:.|..|||.:.|.|:||||...|:.|.           
Yeast   588 FQTAWERRVHAQKGIIGSEPYVAPEEFVDGEYYDPRLIDCWSCGVVYITMILGHYLWKVASREKD 652

  Fly   277 LPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHILAPVKIR-YNIPQVKEDPWYSPSK 337
            :.||  ..:..::|.||..||       .|.||:...:....||. |.|.|      :.|.|
Yeast   653 MSYD--EFYKEMQRKNQFRVF-------EELKHVNSELATNRKIALYRIFQ------WEPRK 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 75/298 (25%)
S_TKc 78..332 CDD:214567 74/294 (25%)
KKQ8NP_012753.2 PKc_like 418..712 CDD:419665 75/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.