DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and PTK2

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_012593.3 Gene:PTK2 / 853522 SGDID:S000003820 Length:818 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:63/261 - (24%)
Similarity:101/261 - (38%) Gaps:89/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGL---HHENLITFYQ 141
            |.||:|..::|:                 |||  |.|.||    ::.|:|.|   :||:...||:
Yeast   259 KPIGSGGSSEVR-----------------KVK--SSYRQK----DVYALKKLNMIYHESPEKFYK 300

  Fly   142 --------SIETSHRVYL---------------------IMQLAENGTLLDYVRER---KFLDEP 174
                    :...||.|::                     ||:|....  |..:.||   |.:...
Yeast   301 RCSKEFIIAKHLSHNVHITNTFYLLKVPTTTYTTRGWGFIMELGVKD--LFQLMERTGWKNVPFN 363

  Fly   175 QSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFA----------RKDTRTSD 229
            :...||||:...:::.|..|:.|||:|.||:|:.:....||.|||.:          ....:|..
Yeast   364 EKYCLFKQVAQGIKFCHDNGIAHRDLKPENVLISKEGICKLTDFGISDWYHVIPHDYTSPVKTCQ 428

  Fly   230 NQVILSKTFCGSYAYASPEILKGVA-----------YDPFMSDIWACGVVCYAMVFGRLPY-DGS 282
            ..:       ||..|..||::...|           |:|...|.:|.|::...|:...:|: |..
Yeast   429 GMI-------GSPPYTPPEVMYFDAKKHYPEKFQKPYNPLAMDSYALGIMLITMINNIIPFIDSC 486

  Fly   283 N 283
            |
Yeast   487 N 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 63/261 (24%)
S_TKc 78..332 CDD:214567 63/261 (24%)
PTK2NP_012593.3 S_TKc 259..562 CDD:214567 63/261 (24%)
STKc_HAL4_like 261..562 CDD:270896 62/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.