DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and HAL5

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_012370.1 Gene:HAL5 / 853274 SGDID:S000003701 Length:855 Species:Saccharomyces cerevisiae


Alignment Length:398 Identity:91/398 - (22%)
Similarity:138/398 - (34%) Gaps:95/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQDLVTDQNSGRRQEQKVYTFSDRPPQPKPPAPSGVVPVKADDKSKPQKTILEEHGIILGKVIGT 84
            |::...:...||....|         |.......|......||.|  .|...:::|..:| |:|.
Yeast   459 SENTKGNNGEGRSNSNK---------QEDSDDTEGKAGTTNDDTS--HKPCSQKYGKSIG-VVGA 511

  Fly    85 GNYAKVKI--------------GFSEEYGKRVAVKIISKVKAPSEYTQKFLPR---EIEAVKGLH 132
            |.|..|||              .:|.  ||::...:......|.:...||..|   |......|.
Yeast   512 GAYGVVKICARCKTAKDVLPYSTYSN--GKKLFFAVKELKPKPGDQIDKFCTRLTSEFIIGHSLS 574

  Fly   133 H-------------------------ENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLD 172
            |                         .|::.....:|.|:....:|:...:|.|...:......:
Yeast   575 HPHFEANAMIAGNVSRTTPPKHVFNAPNILKILDLMEYSNSFVEVMEFCASGDLYSLLTRNNISN 639

  Fly   173 EP---QSRTL-------------------FKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKL 215
            |.   .||.:                   .|||::.|:|:|..|:.|.|:|.||:|...|..||:
Yeast   640 ESNNGSSRLIQTVKEGSGSPLHPLEADCFMKQLLNGVQYMHDHGIAHCDLKPENILFQPNGLLKI 704

  Fly   216 IDFGFARKDTRTSDNQVILSKTFCGSYAYASP-EILKGVAYDPFMSDIWACGVVCYAMVFGR--- 276
            .|||.:.......:..|.......||..|.:| |.::...|||.:.|.|:||:|...||.|:   
Yeast   705 CDFGTSSVFQTAWEKHVHFQSGAMGSEPYVAPEEFIRDAEYDPRLVDCWSCGIVYCTMVMGQYLW 769

  Fly   277 ---LPYDGSNVHILLKRI---NQSLVFPKSPSASSECKHMIMHIL------APVKIRYNIPQVKE 329
               :|...|.....|..|   .|..:|.:....|||...:....|      .|.| |..|.|:.:
Yeast   770 KIAIPEKDSLFKSFLSEIKDDGQFYLFEELRHVSSELNRLRKIALYRTFQVDPTK-RITIEQLLQ 833

  Fly   330 DPWYSPSK 337
            ..|...:|
Yeast   834 SSWMRKTK 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 79/337 (23%)
S_TKc 78..332 CDD:214567 78/333 (23%)
HAL5NP_012370.1 PKc_like 509..837 CDD:419665 76/330 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.