DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and GIN4

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_010795.3 Gene:GIN4 / 852119 SGDID:S000002915 Length:1142 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:106/322 - (32%)
Similarity:162/322 - (50%) Gaps:58/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VPVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISK-------VKAP 113
            :|...|:...|.|         ||:.:|.|:..||::..:...|:..|||:|||       |...
Yeast     8 IPAIKDNTIGPWK---------LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGT 63

  Fly   114 S---EYTQKFLP----REIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFL 171
            |   ..|...||    |||..:|.|:|.|::..|...||:..:||:::.||.|.|.:.:.||..|
Yeast    64 SIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128

  Fly   172 DEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSK 236
            .|.::...|:|::..|.|.|:.|:||||:|.||||||..:|:|:.|||.|..:|...     |.:
Yeast   129 PEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK-----LLE 188

  Fly   237 TFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYD--GSNVHILLKRINQ-SLVFP 298
            |.|||..||:|||:.|:.|..|.||:|:|||:.:|::.||||:|  ..|:..||.::.: ....|
Yeast   189 TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253

  Fly   299 KSPSASSECKHMIMHILA---------------PVKIRYNIPQV----------KEDPWYSP 335
            .....|.|.:.:|..||.               |:..:|  |.:          :||.:.:|
Yeast   254 SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY--PSIRDSKSIRGLPREDTYLTP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 101/299 (34%)
S_TKc 78..332 CDD:214567 101/295 (34%)
GIN4NP_010795.3 PKc_like 17..289 CDD:419665 99/285 (35%)
Kcc4p_like_C 1026..1139 CDD:213379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.