DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and SNF1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_010765.3 Gene:SNF1 / 852088 SGDID:S000002885 Length:633 Species:Saccharomyces cerevisiae


Alignment Length:278 Identity:98/278 - (35%)
Similarity:162/278 - (58%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SKPQKTILEEHGIILG-----KVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPR 123
            :.|:.::.:  |..:|     |.:|.|::.|||:.:....|::||:|||:|........|..:.|
Yeast    40 NNPKSSLAD--GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIER 102

  Fly   124 EIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVE 188
            ||..::.|.|.::|..|..|::...:.::::.|.| .|.||:.:|..:.|.::|..|:|::||||
Yeast   103 EISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGN-ELFDYIVQRDKMSEQEARRFFQQIISAVE 166

  Fly   189 YIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGV 253
            |.|...:||||:|.|||||||:.|:|:.|||.:  :..|..|   ..||.|||..||:||::.|.
Yeast   167 YCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS--NIMTDGN---FLKTSCGSPNYAAPEVISGK 226

  Fly   254 AYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSL-VFPK--SPSASSECKHMIMHIL 315
            .|.....|:|:|||:.|.|:..|||:|..::.:|.|.|:..: ..||  ||.|:...|.|:  |:
Yeast   227 LYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRML--IV 289

  Fly   316 APVKIRYNIPQVKEDPWY 333
            .|:. |.:|.::.:|.|:
Yeast   290 NPLN-RISIHEIMQDDWF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 96/265 (36%)
S_TKc 78..332 CDD:214567 95/261 (36%)
SNF1NP_010765.3 STKc_AMPK_alpha 52..306 CDD:270981 95/262 (36%)
UBA_2 344..389 CDD:400760
AdenylateSensor 504..626 CDD:406881
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.