DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and VHS1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_010533.1 Gene:VHS1 / 851834 SGDID:S000002655 Length:461 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:60/249 - (24%)
Similarity:106/249 - (42%) Gaps:40/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGK---------RVAVKIISKVKAPSEYT 117
            |:....|.:::.:|:.....:|.....|..:...::..|         ||....:..::..||..
Yeast    35 DRQYAIKAVVQSYGVSKEADMGNDKIHKNSVKLQKKLAKLFKESKNVVRVPSIDLESIENMSEED 99

  Fly   118 QKFLP--REIEA-VKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEP-QSRT 178
            .|.||  :||.. ::..||:|::|.::.::::...:::|...........|..|.|:... ..:.
Yeast   100 FKKLPHYKEISLHLRVHHHKNIVTIHEVLQSAVCTFIVMDYYPTDLFTSIVDNRHFVTNGLLVKK 164

  Fly   179 LFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYA 243
            :|.|:.||:.|.|..|:.|.|||.||||||...|:.|.|||.:...|....|..|      ||..
Yeast   165 VFLQICSALNYCHEHGIYHCDIKPENLLLDTEDNVFLCDFGLSTTSTYIKPNVCI------GSSY 223

  Fly   244 YASPEILKGVAYDPFMS------------------DIWACGVVCYAMVFGRLPY 279
            |..||   .:::|..:|                  |:|:.|::...:...|.|:
Yeast   224 YMPPE---RISFDGRVSSSKSGGHKLGKVCPSCNGDLWSLGIILINLTCIRNPW 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 58/236 (25%)
S_TKc 78..332 CDD:214567 57/233 (24%)
VHS1NP_010533.1 STKc_Pat1_like 11..330 CDD:270895 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.