DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and CIPK18

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_174217.1 Gene:CIPK18 / 839797 AraportID:AT1G29230 Length:520 Species:Arabidopsis thaliana


Alignment Length:323 Identity:95/323 - (29%)
Similarity:162/323 - (50%) Gaps:43/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DRPPQPKPPAPS--------------GVVPVKADDKSKPQ----------KTILEEHGIILGKVI 82
            |.||.|.||.|.              |::....|....||          ..::.::.  |||::
plant    18 DPPPPPPPPHPKPYALRYMADLLGRIGIMDTDKDGNISPQSPRSPRSPRNNILMGKYE--LGKLL 80

  Fly    83 GTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSH 147
            |.|.:|||.:..:.:.|.:||:|:|.|.|.........:.|||..::.:.|..::..::.:.|..
plant    81 GHGTFAKVYLAQNIKSGDKVAIKVIDKEKIMKSGLVAHIKREISILRRVRHPYIVHLFEVMATKS 145

  Fly   148 RVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWN 212
            ::|.:|:....|.|.:.|.:.: |.|..:|..|:||:|:|.:.|.:||.|||:|.||||||...|
plant   146 KIYFVMEYVGGGELFNTVAKGR-LPEETARRYFQQLISSVSFCHGRGVYHRDLKPENLLLDNKGN 209

  Fly   213 LKLIDFGFA------RKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYA 271
            ||:.|||.:      |:|.        |..||||:.||.:||:|....||...:|:|:|||:.:.
plant   210 LKVSDFGLSAVAEQLRQDG--------LCHTFCGTPAYIAPEVLTRKGYDAAKADVWSCGVILFV 266

  Fly   272 MVFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHIL-APVKIRYNIPQVKEDPWY 333
            ::.|.:|:...|:.::.|:|.:. .|......||:...::..:| .....|..||::.::.|:
plant   267 LMAGHIPFYDKNIMVMYKKIYKG-EFRCPRWFSSDLVRLLTRLLDTNPDTRITIPEIMKNRWF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 83/264 (31%)
S_TKc 78..332 CDD:214567 83/260 (32%)
CIPK18NP_174217.1 PKc_like 73..327 CDD:419665 83/265 (31%)
CIPK_C 388..499 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.