DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and TSSK1B

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_114417.1 Gene:TSSK1B / 83942 HGNCID:14968 Length:367 Species:Homo sapiens


Alignment Length:273 Identity:123/273 - (45%)
Similarity:181/273 - (66%) Gaps:11/273 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHE 134
            :|:..|.:||..:|.|:|||||..:||.....||:|||.:.|||:::.:||||||||.:..|:|.
Human     6 VLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC 70

  Fly   135 NLITFYQSIETSH-RVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHR 198
            ::|..|:..|||| :||::|:||..|.||:.::.|..|.|.::|..|.||..|::|.|...||||
Human    71 SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHR 135

  Fly   199 DIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIW 263
            |:||:|||||:::|:||.||.|:::..|....::.||||||||.|||:||:|:|:.|.|.:.|||
Human   136 DLKCDNLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIW 200

  Fly   264 ACGVVCYAMVFGRLPYDGSNVHILLK-----RINQSLVFPKSPSASSECKHMIMHILAP-VKIRY 322
            :.||:.|.||.|.:|||.||:..:|:     |:|    ||:|...:.|||.:|.|:|.| |..|.
Human   201 SLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVN----FPRSKHLTGECKDLIYHMLQPDVNRRL 261

  Fly   323 NIPQVKEDPWYSP 335
            :|.::....|..|
Human   262 HIDEILSHCWMQP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 120/264 (45%)
S_TKc 78..332 CDD:214567 119/260 (46%)
TSSK1BNP_114417.1 STKc_TSSK1_2-like 10..272 CDD:271067 120/265 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 233 1.000 Domainoid score I2402
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3315
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 1 1.000 - - FOG0007569
OrthoInspector 1 1.000 - - otm41276
orthoMCL 1 0.900 - - OOG6_103794
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.