DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and CIPK21

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_568860.1 Gene:CIPK21 / 835868 AraportID:AT5G57630 Length:416 Species:Arabidopsis thaliana


Alignment Length:265 Identity:93/265 - (35%)
Similarity:150/265 - (56%) Gaps:15/265 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQS 142
            :|:.||.||:||||:|:....|..||||||.|.....:..:..:.|||..:|.|:|.|::..::.
plant    14 IGRTIGEGNFAKVKLGYDTTNGTYVAVKIIDKALVIQKGLESQVKREIRTMKLLNHPNIVQIHEV 78

  Fly   143 IETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLL 207
            |.|..::.::|:....|.|.|.:..:| :.|..:|.||:||:.||:|.|::||.|||:|.:||||
plant    79 IGTKTKICIVMEYVSGGQLSDRLGRQK-MKESDARKLFQQLIDAVDYCHNRGVYHRDLKPQNLLL 142

  Fly   208 DENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAM 272
            |...|||:.|||.:.. .::.|    :..|.|||..|.:||::....|.....|:|:|||:.:.:
plant   143 DSKGNLKVSDFGLSAV-PKSGD----MLSTACGSPCYIAPELIMNKGYSGAAVDVWSCGVILFEL 202

  Fly   273 VFGRLPYDGSNVHILLKRI-NQSLVFPKSPSASSECKHMIMHILAPVKI-RYNIPQ-VKEDPW-- 332
            :.|..|:|...:.:|.|:| .....||  |..:.|.|.:|.:||.|..: |..:.: :.:|.|  
plant   203 LAGYPPFDDHTLPVLYKKILRADYTFP--PGFTGEQKRLIFNILDPNPLSRITLAEIIIKDSWFK 265

  Fly   333 --YSP 335
              |:|
plant   266 IGYTP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 91/261 (35%)
S_TKc 78..332 CDD:214567 90/256 (35%)
CIPK21NP_568860.1 PKc_like 11..263 CDD:419665 90/256 (35%)
CIPK_C 297..411 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.