DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and NUAK2

DIOPT Version :10

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_112214.3 Gene:NUAK2 / 81788 HGNCID:29558 Length:628 Species:Homo sapiens


Alignment Length:274 Identity:99/274 - (36%)
Similarity:146/274 - (53%) Gaps:21/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PKPPAPSGVVPVKADDKSKPQKTILEE-------------HGIILGKVIGTGNYAKVKIGFSEEY 98
            |.|.|.....|: |:...|..|.::::             |.....:.:|.|.|.|||.. .|..
Human    12 PTPSAAELARPL-AEGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFLETLGKGTYGKVKKA-RESS 74

  Fly    99 GKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLD 163
            |:.||:|.|.|.|...|.....:.||||.:..|:|.::|..::..|.|.::.::|:.|..|.|.|
Human    75 GRLVAIKSIRKDKIKDEQDLMHIRREIEIMSSLNHPHIIAIHEVFENSSKIVIVMEYASRGDLYD 139

  Fly   164 YVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTS 228
            |:.||:.|.|.::|..|:|:||||.|.|...|||||:|.||:|||.|.|:|:.|||.:     ..
Human   140 YISERQQLSEREARHFFRQIVSAVHYCHQNRVVHRDLKLENILLDANGNIKIADFGLS-----NL 199

  Fly   229 DNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQ 293
            .:|....:|||||..||||||:.|..|.....|.|:.||:.|.:|.|.:|:||.:..||:|:|:.
Human   200 YHQGKFLQTFCGSPLYASPEIVNGKPYTGPEVDSWSLGVLLYILVHGTMPFDGHDHKILVKQISN 264

  Fly   294 SLVFPKSPSASSEC 307
            . .:.:.|..|..|
Human   265 G-AYREPPKPSDAC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 91/233 (39%)
NUAK2NP_112214.3 STKc_NUAK2 49..303 CDD:271063 92/236 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..493
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..562
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.