DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and TSSK3

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_443073.1 Gene:TSSK3 / 81629 HGNCID:15473 Length:268 Species:Homo sapiens


Alignment Length:267 Identity:111/267 - (41%)
Similarity:174/267 - (65%) Gaps:12/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHEN 135
            |..:|..|||.||.|.|:|||..||:::.::||:|:|.|:..|.|:.|:|||||::.|:.|.|:|
Human     5 LLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKN 69

  Fly   136 LITFYQSIETSH-RVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRD 199
            :|..|:.:|::. ::.|:|:|||.|.:.|.|.....|.|.:::.||:|:|.|:.|.|..||.|||
Human    70 IIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCHGCGVAHRD 134

  Fly   200 IKCENLLLDENWNLKLIDFGFAR---KDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSD 261
            :||||.|| :.:||||.|||||:   |..|.      ||:|||||.|||:||:|:|:.:|....|
Human   135 LKCENALL-QGFNLKLTDFGFAKVLPKSHRE------LSQTFCGSTAYAAPEVLQGIPHDSKKGD 192

  Fly   262 IWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHILAP-VKIRYNIP 325
            :|:.|||.|.|:...||:|.:::..:|.:..:.:.||...|.|::|:.::..:|.| :.:|.:|.
Human   193 VWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLSISADCQDLLKRLLEPDMILRPSIE 257

  Fly   326 QVKEDPW 332
            :|...||
Human   258 EVSWHPW 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 110/263 (42%)
S_TKc 78..332 CDD:214567 107/258 (41%)
TSSK3NP_443073.1 STKc_TSSK3-like 9..265 CDD:271065 110/263 (42%)
S_TKc 10..265 CDD:214567 109/262 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 233 1.000 Domainoid score I2402
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D403296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41276
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.