DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Brsk2

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001009930.1 Gene:Brsk2 / 75770 MGIID:1923020 Length:719 Species:Mus musculus


Alignment Length:261 Identity:82/261 - (31%)
Similarity:144/261 - (55%) Gaps:8/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQS 142
            |.|.:|.|....||:|......::||:||:::.|.......| :.|||..:|.:.|.:::..:..
Mouse    22 LEKTLGKGQTGLVKLGIHCVTCQKVAIKIVNREKLSESVLMK-VEREIAILKLIEHPHVLKLHDV 85

  Fly   143 IETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLL 207
            .|....:||:::....|.|.||:.::..|...::|..|:|::||:::.||..:.|||:|.|||||
Mouse    86 YENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLL 150

  Fly   208 DENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYAM 272
            ||..|:::.|||.|......|     |.:|.|||..||.||:::|..||...:|:|:|||:.:|:
Mouse   151 DERNNIRIADFGMASLQVGDS-----LLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFAL 210

  Fly   273 VFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHIL-APVKIRYNIPQVKEDPWYSPS 336
            :.|.||:|..|:..||:::.:. ||........:|:.::..:: .....|..:..:::..||...
Mouse   211 LVGALPFDDDNLRQLLEKVKRG-VFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGG 274

  Fly   337 K 337
            |
Mouse   275 K 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 79/255 (31%)
S_TKc 78..332 CDD:214567 79/254 (31%)
Brsk2NP_001009930.1 STKc_BRSK1_2 18..271 CDD:270983 79/255 (31%)
UBA_BRSK 298..351 CDD:270525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.