DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Prkaa1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_062015.2 Gene:Prkaa1 / 65248 RGDID:3387 Length:559 Species:Rattus norvegicus


Alignment Length:260 Identity:101/260 - (38%)
Similarity:153/260 - (58%) Gaps:11/260 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQ 141
            |||..:|.|.:.|||:|..|..|.:|||||:::.|..|......:.|||:.:|...|.::|..||
  Rat    28 ILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQ 92

  Fly   142 SIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLL 206
            .|.|...::::|:....|.|.||:.:...|||.:||.||:|::|.|:|.|...|||||:|.||:|
  Rat    93 VISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVL 157

  Fly   207 LDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCYA 271
            ||.:.|.|:.|||.:   ...||.:.:  :|.|||..||:||::.|..|.....|||:.||:.||
  Rat   158 LDAHMNAKIADFGLS---NMMSDGEFL--RTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYA 217

  Fly   272 MVFGRLPYDGSNVHILLKRINQSLVF-PK--SPSASSECKHMIMHILAPVKIRYNIPQVKEDPWY 333
            ::.|.||:|..:|..|.|:|...:.: |:  :||..|..|||:.  :.|:| |..|..::|..|:
  Rat   218 LLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQ--VDPMK-RATIKDIREHEWF 279

  Fly   334  333
              Rat   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 100/258 (39%)
S_TKc 78..332 CDD:214567 99/256 (39%)
Prkaa1NP_062015.2 STKc_AMPK_alpha 24..279 CDD:270981 100/258 (39%)
UBA_AID_AAPK1 296..360 CDD:270586
AIS. /evidence=ECO:0000250 302..381
AMPKA1_C 404..557 CDD:213384
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.