DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Mark2

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_006230941.1 Gene:Mark2 / 60328 RGDID:708483 Length:841 Species:Rattus norvegicus


Alignment Length:288 Identity:109/288 - (37%)
Similarity:171/288 - (59%) Gaps:14/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KPPAPSGVVPVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKA 112
            ||.:.|.::..:....|..::..:..:.::  |.||.||:||||:......||.||||||.|.:.
  Rat    27 KPSSKSNMLRGRNSATSADEQPHIGNYRLL--KTIGKGNFAKVKLARHILTGKEVAVKIIDKTQL 89

  Fly   113 PSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSR 177
            .|...|| |.||:..:|.|:|.|::..::.|||...:||:|:.|..|.:.||:.....:.|.::|
  Rat    90 NSSSLQK-LFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEAR 153

  Fly   178 TLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSY 242
            ..|:|:||||:|.|.|.:||||:|.||||||.:.|:|:.||||:.:  .|..|::   .|||||.
  Rat   154 AKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNE--FTFGNKL---DTFCGSP 213

  Fly   243 AYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSP-SASSE 306
            .||:||:.:|..||....|:|:.||:.|.:|.|.||:||.|:..|.:|:.:...  :.| ..|::
  Rat   214 PYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKY--RIPFYMSTD 276

  Fly   307 CKHMIMH--ILAPVKIRYNIPQVKEDPW 332
            |::::..  ||.|.| |..:.|:.:|.|
  Rat   277 CENLLKKFLILNPSK-RGTLEQIMKDRW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 105/261 (40%)
S_TKc 78..332 CDD:214567 104/256 (41%)
Mark2XP_006230941.1 STKc_MARK 52..304 CDD:270974 105/263 (40%)
S_TKc 53..304 CDD:214567 105/262 (40%)
UBA_MARK2 322..363 CDD:270589
MARK2_C 742..840 CDD:213386
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.