DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and Brsk1

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001120809.1 Gene:Brsk1 / 499073 RGDID:1563268 Length:778 Species:Rattus norvegicus


Alignment Length:296 Identity:97/296 - (32%)
Similarity:158/296 - (53%) Gaps:29/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PQPKPPAPSGVV-PVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIIS 108
            |.|.||..:..| |.:                  |.|.:|.|....||:|.....|::|||||::
  Rat    20 PHPHPPQHAQYVGPYR------------------LEKTLGKGQTGLVKLGVHCITGQKVAVKIVN 66

  Fly   109 KVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDE 173
            :.|.......| :.|||..:|.:.|.:::..:...|....:||:::....|.|.||:.::..|..
  Rat    67 REKLSESVLMK-VEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTP 130

  Fly   174 PQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTF 238
            .::|..|:|:|||:::.||..:.|||:|.|||||||..|:::.|||.|......|     |.:|.
  Rat   131 KEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDS-----LLETS 190

  Fly   239 CGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSPSA 303
            |||..||.||::||..||...:|:|:|||:.:|::.|.||:|..|:..||:::.:. ||......
  Rat   191 CGSPHYACPEVIKGEKYDGRRADMWSCGVILFALLVGALPFDDDNLRQLLEKVKRG-VFHMPHFI 254

  Fly   304 SSECKHMI--MHILAPVKIRYNIPQVKEDPWYSPSK 337
            ..:|:.::  |..:.|.| |.::.|:::.|||...|
  Rat   255 PPDCQSLLRGMIEVEPEK-RLSLEQIQKHPWYLGGK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 88/259 (34%)
S_TKc 78..332 CDD:214567 87/255 (34%)
Brsk1NP_001120809.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 4/8 (50%)
STKc_BRSK1_2 32..285 CDD:270983 89/278 (32%)
S_TKc 34..284 CDD:214567 87/275 (32%)
UBA_BRSK 314..367 CDD:270525
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 719..778
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.