DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and AMPKalpha

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster


Alignment Length:291 Identity:103/291 - (35%)
Similarity:163/291 - (56%) Gaps:14/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PQPKPPAPSGVVPVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISK 109
            ||.:..|...|    |...:..|..:...| .:||..:|||.:.|||||..:....:|||||:::
  Fly     2 PQMRAAAAEAV----AAGSANGQPLVKIGH-YLLGATLGTGTFGKVKIGEHQITRVKVAVKILNR 61

  Fly   110 VKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEP 174
            .|..|......:.|||:.:|...|.::|..||.|.|...:::||:....|.|.||:.:...|.|.
  Fly    62 QKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEH 126

  Fly   175 QSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFC 239
            |:|..|:|::|.|:|.|...:||||:|.||||||.|.::|:.|||.:   ....|.:.:  :|.|
  Fly   127 QARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLS---NMMLDGEFL--RTSC 186

  Fly   240 GSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSPSAS 304
            ||..||:||::.|..|.....|||:|||:.||::.|.||:|..:|..|.::| :|.:||.....:
  Fly   187 GSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKI-KSGIFPIPEYLN 250

  Fly   305 SECKHMIMHILA--PVKIRYNIPQVKEDPWY 333
            .:..:::..:|.  |:| |.||.::|:..|:
  Fly   251 KQVVNLVCQMLQVDPLK-RANIEEIKKHEWF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 95/259 (37%)
S_TKc 78..332 CDD:214567 95/255 (37%)
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 96/262 (37%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.