DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9222 and CG10177

DIOPT Version :9

Sequence 1:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:243 Identity:62/243 - (25%)
Similarity:117/243 - (48%) Gaps:25/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RVAVKIISKVKAPSEYTQKFLPREIEAVKGLH-HENLITFYQSIETSHRVYLIMQLAENGTLLDY 164
            :..||:::|....::....::  |.|.::.|. |.|:|....::|....:|.:::..: ..:...
  Fly   174 KCTVKMVNKQTQSNDRGDTYM--EAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLD-CNMQKV 235

  Fly   165 VRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLLL---DENWNLKLIDFGFARKDTR 226
            :::|..|.|..:|::.:..|||:.::|...|:|||||.||||:   ...||.|::.  .|..|..
  Fly   236 IQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVK--VANFDLA 298

  Fly   227 TSDNQVILSKTF--CGSYAYASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDG---SNVHI 286
            |....   ||.:  ||:..|.:||::....|| :..|.|:.||..:.|:.|::|:..   ::..|
  Fly   299 TYYRG---SKLYVRCGTPCYMAPEMIAMSGYD-YQVDSWSLGVTLFYMLCGKMPFASACKNSKEI 359

  Fly   287 LLKRINQSLVFPKSPSA--SSECKHMIMHILA--PVKIRYNIPQVKED 330
            ....::....:||...:  |.|...:|..:|.  |   .|.:|..:.|
  Fly   360 YAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDP---SYRVPIAELD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 62/243 (26%)
S_TKc 78..332 CDD:214567 62/243 (26%)
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 62/243 (26%)
PKc_like 164..403 CDD:304357 61/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.